k-dense-ai/scientific-agent-skills · skills/glycoengineering/SKILL.md

glycoengineering skillB

glycoengineering is agent-read markdown (skill) from k-dense-ai/scientific-agent-skills: Analyze and engineer protein glycosylation. Scan sequences for N-glycosylation sequons (N-X-S/T), predict O-glycosylation hotspots, and access curated glycoengineering tools (NetOGlyc, GlycoShield, GlycoWorkbench). For glycoprotein engineering, therapeutic antibody optimization, and vaccine design..

Indexed from public GitHub and served as immutable, content-addressed versions. Install it pinned to an exact SHA-256 with the mdr CLI, and every file is verified against the hash recorded here before it reaches your agent. The deterministic audit below grades the latest version, and the same file always earns the same grade.

How to install

Latest version
mdr add k-dense-ai/scientific-agent-skills/glycoengineering@v1.2
Exact content
mdr add k-dense-ai/scientific-agent-skills/glycoengineering@sha256:66bd9a2560de369d

Pin to a label to follow the author's releases, or to a sha256 to freeze the exact bytes forever. Either way the resolved hash is written to mdr.lock, and mdr install reproduces it on any machine.

Badge

mdr badge

[![mdr](https://markdownregistry.com/badge/art_xk3ke64cba5k7hjw.svg)](https://markdownregistry.com/a/art_xk3ke64cba5k7hjw)

0 badge views in 30 days

Versions

versioncommittedcommitsizeaudit
v1.2 latest2026-09-11 30e0910 13,810 BB view · diff
v1.12026-07-31 4226ca8 12,480 BB view · diff
v1.02026-07-31 bd99c01 12,480 BB view · diff
v1.02026-07-26 b085e11 12,477 BB view · diff
git:20260611.1b8fae32026-06-11 1b8fae3 12,482 BB view

Audit of the latest version

B  16 of 17 checks passed. Deterministic, no model, same answer every run.
  • fail: No base64 blob over 200 characters (matched: APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA)
  • pass: Frontmatter block present
  • pass: Frontmatter declares a name
  • pass: Frontmatter declares a description
  • pass: Size between 200 bytes and 200 KB (13810 bytes)
  • pass: No zero-width or bidi control characters
  • pass: No instruction hidden inside an HTML comment
  • pass: No link to an exfiltration or paste host
  • pass: No credential-shaped string
  • pass: No instruction to send local credentials anywhere
  • pass: No text hidden with inline styles
  • pass: No prompt-injection phrasing
  • pass: No curl or wget piped into a shell
  • pass: No recursive delete of root, home or parent
  • pass: No instruction to read or print local credentials
  • pass: No link to a raw IP address
  • pass: No script tag

Source

GitHub

k-dense-ai/scientific-agent-skills · 44,464 stars · license MIT · pushed 2026-09-11 · branch main

API

GET https://markdownregistry.com/api/v1/artifacts/art_xk3ke64cba5k7hjw
GET https://markdownregistry.com/api/v1/resolve?ref=k-dense-ai/scientific-agent-skills/glycoengineering
GET https://markdownregistry.com/api/v1/blob/66bd9a2560de369d57b798a819f4895a19d1ff9c65e9f3176fb4abd780422d52