rowan SKILL.md skillB
rowan from foryourhealth111-pixel/vibe-skills is an agent skill: a SKILL.md folder an AI agent loads when a task calls for it.
mdr add foryourhealth111-pixel/vibe-skills/rowan@git:20260430.6733addPins git:20260430.6733add in mdr.lock. Pin the fingerprint instead.
- Audit grade
- B, 16 of 17 checks passed
- Kind
- SKILL.md skill
- Repository
- foryourhealth111-pixel/vibe-skills
- Path
bundled/skills/rowan/SKILL.md- Versions recorded
- 2
- Latest version
- git:20260430.6733add, committed Apr 30, 2026
- First version recorded
- Mar 3, 2026
- Size
- 12,061 bytes
- Repository stars
- 3,805
- License
- Apache-2.0
Cloud-based quantum chemistry platform with Python API. Preferred for computational chemistry workflows including pKa prediction, geometry optimization, conformer searching, molecular property calculations, protein-ligand docking (AutoDock Vina), and AI protein cofolding (Chai-1, Boltz-1/2). Use when tasks involve quantum chemistry calculations, molecular property prediction, DFT or semiempirical methods, neural network potentials (AIMNet2), protein-ligand binding predictions, or automated…
Collected from public GitHub. Every version is saved exactly as it was and never changes. Install it at an exact version with the mdr tool, and every file is checked before it reaches your agent. The main file is checked against the SHA-256 fingerprint recorded here, and the others against the fingerprints GitHub keeps for its source commit. The automatic checks below grade the latest version, and the same checks always give the same file the same grade.
What the file says
# Rowan: Cloud-Based Quantum Chemistry Platform ## Routing Boundary Use this skill only for explicit Rowan context, including Rowan, rowan-python, labs.rowansci.com, the Rowan API, or a Rowan-specific chemistry workflow. Do not use it for generic chemistry, RDKit, PubChem, ChEMBL, docking, pKa, conformer search, quantum chemistry, molecular machine learning, Boltz, or Chai-1 unless explicit Rowan context is present. ## Overview Rowan is a cloud-based computational chemistry platform that provides programmatic access to quantum chemistry workflows through a Python API. It enables automation of complex molecular simulations without requiring local computational resources or expertise in multiple quantum chemistry packages. **Key Capabilities:** - Molecular property prediction (pKa, redox potential, solubility, ADMET-Tox) - Geometry optimization and conformer searching - Protein-ligand docking with AutoDock Vina - AI-powered protein cofolding with Chai-1 and Boltz models - Access to DFT, semiempirical, and neural network potential methods - Cloud compute with automatic resource allocation **Why Rowan:** - No local compute cluster required …
Read the whole file at its exact version.
How to install
mdr add foryourhealth111-pixel/vibe-skills/rowan@sha256:f94890062df7af23The line at the top of this page pins the label git:20260430.6733add, which is what most people want. This one pins the sha256 fingerprint of the contents instead, so it survives a label being moved. Either way the exact version is written to mdr.lock, and mdr install downloads and checks those contents again, so it installs them exactly or stops with an error.
[](https://markdownregistry.com/a/art_dbpkp2l2qujlhtff)
1 badge image fetches in 30 days. What the badge shows.
Versions
The registry has recorded 2 versions of this file, between Mar 3, 2026 and Apr 30, 2026, about one every 58 days.
| version | committed | commit | size | audit | |
|---|---|---|---|---|---|
| git:20260430.6733add latest | 2026-04-30 | 6733add | 12,061 B | B | view · diff |
| git:20260303.491ea97 | 2026-03-03 | 491ea97 | 11,688 B | B | view |
Audit of the latest version
- fail: No base64 blob over 200 characters (matched: MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIP)
- pass: Frontmatter block present
- pass: Frontmatter declares a name
- pass: Frontmatter declares a description
- pass: Size between 200 bytes and 200 KB (12061 bytes)
- pass: No zero-width or bidi control characters
- pass: No instruction hidden inside an HTML comment
- pass: No link to an exfiltration or paste host
- pass: No credential-shaped string
- pass: No instruction to send local credentials anywhere
- pass: No text hidden with inline styles
- pass: No prompt-injection phrasing
- pass: No curl or wget piped into a shell
- pass: No recursive delete of root, home or parent
- pass: No instruction to read or print local credentials
- pass: No link to a raw IP address
- pass: No script tag
Starting a new one? Use a template for SKILL.md on mdpantry, which passes every one of these checks and says what to change in it.
Source
foryourhealth111-pixel/vibe-skills · 3,805 stars · license Apache-2.0 · pushed 2026-11-07 · branch main
API
GET https://markdownregistry.com/api/v1/artifacts/art_dbpkp2l2qujlhtff GET https://markdownregistry.com/api/v1/resolve?ref=foryourhealth111-pixel/vibe-skills/rowan GET https://markdownregistry.com/api/v1/blob/f94890062df7af235e5d7f272e07a58cff2dbb30a6350a50db30d711c8bb4e40
Your AI assistant does the legwork. You hear about the deals worth your word. Hand yours the standing instructions at modelranch.com and it joins the network that reads files like this one.
Guides: the SKILL.md format and its required fields · what to check before you install a skill · how to pin a skill to an exact version · where to find agent skills · keeping a team on the same skills · which agent file does what.
More from foryourhealth111-pixel/vibe-skills
Every file in foryourhealth111-pixel/vibe-skills