glycoengineering SKILL.md skillB
glycoengineering from marielynneblock/arcanum-artifex is an agent skill: a SKILL.md folder an AI agent loads when a task calls for it.
mdr add marielynneblock/arcanum-artifex/glycoengineering@git:20260710.0115f49Pins git:20260710.0115f49 in mdr.lock. Pin the fingerprint instead.
- Audit grade
- B, 16 of 17 checks passed
- Kind
- SKILL.md skill
- Repository
- marielynneblock/arcanum-artifex
- Path
skills/scientific/glycoengineering/SKILL.md- Versions recorded
- 4
- Latest version
- git:20260710.0115f49, committed Jul 10, 2026
- First version recorded
- Apr 6, 2026
- Size
- 12,462 bytes
- Repository stars
- 4
- License
- none declared
Analyse and engineer protein glycosylation. Scan sequences for N-glycosylation sequons (N-X-S/T), predict O-glycosylation hotspots, and access curated glycoengineering tools (NetOGlyc, GlycoShield, GlycoWorkbench). For glycoprotein engineering, therapeutic antibody optimisation, and vaccine design.
Collected from public GitHub. Every version is saved exactly as it was and never changes. Install it at an exact version with the mdr tool, and every file is checked before it reaches your agent. The main file is checked against the SHA-256 fingerprint recorded here, and the others against the fingerprints GitHub keeps for its source commit. The automatic checks below grade the latest version, and the same checks always give the same file the same grade.
What the file says
# Glycoengineering ## Overview Glycosylation is the most common and complex post-translational modification (PTM) of proteins, affecting over 50% of all human proteins. Glycans regulate protein folding, stability, immune recognition, receptor interactions, and pharmacokinetics of therapeutic proteins. Glycoengineering involves rational modification of glycosylation patterns for improved therapeutic efficacy, stability, or immune evasion. **Two major glycosylation types:** - **N-glycosylation**: Attached to asparagine (N) in the sequon N-X-[S/T] where X ≠ Proline; occurs in the ER/Golgi - **O-glycosylation**: Attached to serine (S) or threonine (T); no strict consensus motif; primarily GalNAc initiation ## When to Use This Skill Use this skill when: - **Antibody engineering**: Optimise Fc glycosylation for enhanced ADCC, CDC, or reduced immunogenicity - **Therapeutic protein design**: Identify glycosylation sites that affect half-life, stability, or immunogenicity - **Vaccine antigen design**: Engineer glycan shields to focus immune responses on conserved epitopes - **Biosimilar characterisation**: Compare glycan patterns between reference and biosimilar …
Read the whole file at its exact version.
How to install
mdr add marielynneblock/arcanum-artifex/glycoengineering@sha256:d60b0d41c3c5b906The line at the top of this page pins the label git:20260710.0115f49, which is what most people want. This one pins the sha256 fingerprint of the contents instead, so it survives a label being moved. Either way the exact version is written to mdr.lock, and mdr install downloads and checks those contents again, so it installs them exactly or stops with an error.
[](https://markdownregistry.com/a/art_uo2okeyo2tgmc3xx)
4 badge image fetches in 30 days. What the badge shows.
Versions
The registry has recorded 4 versions of this file, between Apr 6, 2026 and Jul 10, 2026, about one every 32 days.
| version | committed | commit | size | audit | |
|---|---|---|---|---|---|
| git:20260710.0115f49 latest | 2026-07-10 | 0115f49 | 12,462 B | B | view · diff |
| git:20260710.ffb3400 | 2026-07-10 | ffb3400 | 12,462 B | B | view · diff |
| git:20260515.b861afb | 2026-05-15 | b861afb | 12,462 B | B | view · diff |
| git:20260406.05dff34 | 2026-04-06 | 05dff34 | 12,462 B | B | view |
Audit of the latest version
- fail: No base64 blob over 200 characters (matched: APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA)
- pass: Frontmatter block present
- pass: Frontmatter declares a name
- pass: Frontmatter declares a description
- pass: Size between 200 bytes and 200 KB (12462 bytes)
- pass: No zero-width or bidi control characters
- pass: No instruction hidden inside an HTML comment
- pass: No link to an exfiltration or paste host
- pass: No credential-shaped string
- pass: No instruction to send local credentials anywhere
- pass: No text hidden with inline styles
- pass: No prompt-injection phrasing
- pass: No curl or wget piped into a shell
- pass: No recursive delete of root, home or parent
- pass: No instruction to read or print local credentials
- pass: No link to a raw IP address
- pass: No script tag
Starting a new one? Use a template for SKILL.md on mdpantry, which passes every one of these checks and says what to change in it.
Source
marielynneblock/arcanum-artifex · 4 stars · license none declared · pushed 2026-09-19 · branch main
API
GET https://markdownregistry.com/api/v1/artifacts/art_uo2okeyo2tgmc3xx GET https://markdownregistry.com/api/v1/resolve?ref=marielynneblock/arcanum-artifex/glycoengineering GET https://markdownregistry.com/api/v1/blob/d60b0d41c3c5b906f1c7aacee9fdc1a15cb776c757a6aa06a29afe5a09457aa7
Your AI assistant does the legwork. You hear about the deals worth your word. Hand yours the standing instructions at modelranch.com and it joins the network that reads files like this one.
Guides: the SKILL.md format and its required fields · what to check before you install a skill · how to pin a skill to an exact version · where to find agent skills · keeping a team on the same skills · which agent file does what.
More from marielynneblock/arcanum-artifex
Every file in marielynneblock/arcanum-artifex